PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G202700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 251aa    MW: 27706.7 Da    PI: 8.5635
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G202700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-15452148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd l+++ v+++G g +W + ++t+g++R++ +c+srw++yl
  Sevir.9G202700.1.p  4 KGKWSKEEDNLIKNHVEKYGIGrSWQALSNTLGLKRCGRSCRSRWLNYL 52
                        79******************999************************97 PP

2Myb_DNA-binding31.34.9e-1059102247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         g++T  E+ ++ +   + G+  W+ Ia+ ++ gRt+  +k++w++ 
  Sevir.9G202700.1.p  59 GNFTLAEERIICEMYSKRGSC-WSVIAAQLP-GRTDLAIKNYWNST 102
                         89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.848156IPR017930Myb domain
SMARTSM007173.0E-11354IPR001005SANT/Myb domain
SuperFamilySSF466891.02E-25399IPR009057Homeodomain-like
PfamPF002493.5E-13452IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-20559IPR009057Homeodomain-like
CDDcd001674.62E-10652No hitNo description
SMARTSM007172.0E-957105IPR001005SANT/Myb domain
PROSITE profilePS5129414.46357107IPR017930Myb domain
PfamPF002499.4E-959102IPR001005SANT/Myb domain
CDDcd001674.34E-760103No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2060106IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MMKKGKWSKE EDNLIKNHVE KYGIGRSWQA LSNTLGLKRC GRSCRSRWLN YLRPGLKHGN  60
FTLAEERIIC EMYSKRGSCW SVIAAQLPGR TDLAIKNYWN STLKKKNPAA RTPPACSTSS  120
DAGTPARDLQ LVAYSSEESS TAGSSPANAK PVLADPPPVP VVTDGQGPIA AVPVSRPVRI  180
EQKQAMVSRS RLEKQQQPPP PACDQTGERI MDIVCAPMSP VPLSFIEPEE LACIYEFDDI  240
DSFLPWFDHH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-24210625127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0798888e-37AC079888.10 Oryza sativa chromosome 10 BAC OSJNBa0078O01 genomic sequence, complete sequence.
GenBankAP0149668e-37AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126188e-37CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.10.0PREDICTED: transcription factor RAX2-like
TrEMBLK4AED71e-172K4AED7_SETIT; Uncharacterized protein
STRINGSi037244m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.17e-44myb domain protein 87